{"product_id":"proteintech-12609-1-ap","title":"Proteintech, 12609-1-AP, WT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WT1 (12609-1-AP) by Proteintech is a Polyclonal antibody targeting WT1 in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n12609-1-AP targets WT1 in WB, IF\/ICC, FC (Intra), IP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, A431 cells,  MCF-7 cells,  mouse kidney tissue,  rat kidney tissue,  MOLT-4  cells\nPositive IP detected in: K-562 cells\nPositive IF\/ICC detected in: K-562 cells\nPositive FC (Intra) detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe WT1 gene encodes a zinc finger DNA-binding protein that acts as a transcriptional activator or repressor depending on the cellular or chromosomal context, and it is required for normal formation of the genitourinary system and mesothelial tissues. WT1 inhibits apoptosis through p53 and Bcl-2 and also inhibits the differentiation of leukemic cells. Function of WT1 may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA. WT1 exists some isoforms with the range of molecular weight is 33-50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken, bovine, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3337 Product name: Recombinant human WT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC032861 Sequence: MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRMHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL Predict reactive species\nFull Name: Wilms tumor 1\nCalculated Molecular Weight: 449 aa, 49 kDa, 57 kDa\nObserved Molecular Weight: 52-55 kDa\nGenBank Accession Number: BC032861\nGene Symbol: WT1\nGene ID (NCBI): 7490\nRRID: AB_2216225\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19544\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868841398441,"sku":"12609-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12609-1-ap","provider":"Iright","version":"1.0","type":"link"}