{"product_id":"proteintech-12629-1-ap","title":"Proteintech, 12629-1-AP, Calmegin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Calmegin (12629-1-AP) by Proteintech is a Polyclonal antibody targeting Calmegin in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12629-1-AP targets Calmegin in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  human brain tissue,  human lung tissue,  mouse brain tissue,  mouse lung tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalmegin, belonging to the calreticulin family, is a testis-specific molecular chaperon of the endoplasmic reticulum playing a key role in spermatogenesis. Western blot analysis of mouse testis showed a single band with an apparent molecular mass of 93 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3322 Product name: Recombinant human CLGN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 311-610 aa of BC028357 Sequence: PAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSFCWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD Predict reactive species\nFull Name: calmegin\nCalculated Molecular Weight: 610 aa, 70 kDa\nObserved Molecular Weight: 93 kDa\nGenBank Accession Number: BC028357\nGene Symbol: Calmegin\nGene ID (NCBI): 1047\nRRID: AB_2276364\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14967\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869520711849,"sku":"12629-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12629-1-ap","provider":"Iright","version":"1.0","type":"link"}