{"product_id":"proteintech-12632-1-ap","title":"Proteintech, 12632-1-AP, LAMP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LAMP3 (12632-1-AP) by Proteintech is a Polyclonal antibody targeting LAMP3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12632-1-AP targets LAMP3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, mouse thymus tissue,  rat lung tissue,  A549 cells,  HEK-293T cells,  Raji cells\nPositive IP detected in: A549 cells\nPositive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLAMP3 (lysosome-associated membrane protein 3), also known as DC-LAMP (DC-lysosome-associated membrane glycoprotein), TSC403 or CD208, is a highly glycosylated lysosomal membrane protein that belongs to the LAMP family. The mature glycoprotein has an apparent molecular mass of 70-90 kDa, which is considerably larger than its predicted mass of 44 kDa (PMID: 9768752). LAMP3 is expressed in lung type II pneumocytes, lymphoid organs and dendritic cells. It might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 mRNA is up-regulated in some human cancers (PMID:9721848). LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer (PMID: 16204031).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3325 Product name: Recombinant human LAMP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-380 aa of BC032940 Sequence: FPGTRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDY Predict reactive species\nFull Name: lysosomal-associated membrane protein 3\nCalculated Molecular Weight: 416 aa, 44 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC032940\nGene Symbol: LAMP3\nGene ID (NCBI): 27074\nRRID: AB_2076629\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UQV4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868866105513,"sku":"12632-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12632-1-ap","provider":"Iright","version":"1.0","type":"link"}