{"product_id":"proteintech-12635-1-ap","title":"Proteintech, 12635-1-AP, GNAO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNAO1 (12635-1-AP) by Proteintech is a Polyclonal antibody targeting GNAO1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12635-1-AP targets GNAO1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, Y79 cells,  human liver tissue,  mouse testis tissue,  rat testis tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNAO1 gene encodes the α subunit of heterotrimeric guanine nucleotide-binding protein (Gi protein), a membrane protein widely expressed in the central nervous system involved in signal transduction (PMID: 30642806). GNAO1 belongs to the G-alpha family and G(i\/o\/t\/z) subfamily. GNAO1 is highly expressed in brain and modulate neuronal excitability (PMID: 30838255). GNAO1 has 2 isoforms with the molecular mass of 40 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3330 Product name: Recombinant human GNAO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC030027 Sequence: MKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O\nCalculated Molecular Weight: 302 aa, 35 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC030027\nGene Symbol: GNAO1\nGene ID (NCBI): 2775\nRRID: AB_2111635\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09471\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868912275625,"sku":"12635-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12635-1-ap","provider":"Iright","version":"1.0","type":"link"}