{"product_id":"proteintech-12638-1-ap","title":"Proteintech, 12638-1-AP, CIAPIN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CIAPIN1 (12638-1-AP) by Proteintech is a Polyclonal antibody targeting CIAPIN1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12638-1-AP targets CIAPIN1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HeLa cells,  Jurkat cells,  K-562 cells,  mouse brain tissue,  mouse liver tissue\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe cytokine-induced anti-apoptotic molecule (CIAPIN1, or DRE2) had been found to be a differentially-expressed gene involved in a variety of cancers, and it was also considered as a candidate tumor suppressor gene in gastric cancer, renal cancer and liver cancer. CIAPIN1 plays an important role in the differentiation of colorectal cancer (CRC) cells, and the differential expression of CIAPIN1 in CRC was closely related to prognosis. CIAPIN1 might play an important role in esophageal carcinogenesis, and it could be considered as a valuable prognostic indicator in esophageal squamous cell carcinoma (ESCC).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3333 Product name: Recombinant human CIAPIN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-312 aa of BC024196 Sequence: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA Predict reactive species\nFull Name: cytokine induced apoptosis inhibitor 1\nCalculated Molecular Weight: 312 aa, 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC024196\nGene Symbol: CIAPIN1\nGene ID (NCBI): 57019\nRRID: AB_2079665\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6FI81\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868978434217,"sku":"12638-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12638-1-ap","provider":"Iright","version":"1.0","type":"link"}