{"product_id":"proteintech-12652-1-ap","title":"Proteintech, 12652-1-AP, TMEM16A\/DOG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM16A\/DOG1 (12652-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM16A\/DOG1 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n12652-1-AP targets TMEM16A\/DOG1 in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human lung cancer tissue, mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANO1 also named as DOG1, ORAOV2, TAOS2 and TMEM16A, acts as a calcium-activated chloride channel. It is required for normal tracheal development. ANO1 (or DOG1) is used as an aid in the identification and diagnosis of gastrointestinal stromal tumors (GIST) within the context of an antibody panel, the patient's clinical history, and other diagnostic tests evaluated by a qualified pathologist. The immunogen is the C-terminal of ANO1. This antibody can recognize isoform1 and isoform2 of human ANO1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3320 Product name: Recombinant human ANO1,DOG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 541-712 aa of BC027590 Sequence: LVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQEIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL Predict reactive species\nFull Name: anoctamin 1, calcium activated chloride channel\nCalculated Molecular Weight: 986 aa, 114 kDa\nObserved Molecular Weight: 114 kDa\nGenBank Accession Number: BC027590\nGene Symbol: TMEM16A\nGene ID (NCBI): 55107\nRRID: AB_2722560\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5XXA6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868930855081,"sku":"12652-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12652-1-ap","provider":"Iright","version":"1.0","type":"link"}