{"product_id":"proteintech-12672-1-ap","title":"Proteintech, 12672-1-AP, SHCBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SHCBP1 (12672-1-AP) by Proteintech is a Polyclonal antibody targeting SHCBP1 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n12672-1-AP targets SHCBP1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  Sp2\/0 cells,  Neuro-2a cells,  HepG2 cells,  mouse thymus tissue\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human liver cancer tissue, human tonsillitis tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSHCBP1 was initially identified as a potential gene associated with cell proliferation in fibroblasts. SHCBP1 exerts a crucial physiological function in normal tissue development. Chen et al. showed that SHCBP1 is an essential component of FGF signaling in neural progenitor cells. SHCBP1 is also upregulated during T cell proliferation and regulates CD4+ T cell effector function in vivo. Recently, SHCBP1 was shown to be closely associated with cancer development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3355 Product name: Recombinant human SHCBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 374-672 aa of BC030699 Sequence: NACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKGDTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGAGIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQESAEDGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF Predict reactive species\nFull Name: SHC SH2-domain binding protein 1\nCalculated Molecular Weight: 672 aa, 76 kDa\nObserved Molecular Weight: 75-85 kDa\nGenBank Accession Number: BC030699\nGene Symbol: SHCBP1\nGene ID (NCBI): 79801\nRRID: AB_10639526\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NEM2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868891992233,"sku":"12672-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12672-1-ap","provider":"Iright","version":"1.0","type":"link"}