{"product_id":"proteintech-12673-1-ap","title":"Proteintech, 12673-1-AP, BRSK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BRSK1 (12673-1-AP) by Proteintech is a Polyclonal antibody targeting BRSK1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12673-1-AP targets BRSK1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse stomach tissue, human ovary tumor tissue,  rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBRSK1(Brain-specific serine\/threonine-protein kinase 1) is also named as KIAA1811, SAD1, SADB and belongs to the SNF1 subfamily. BRSKs are crucial for establishing neuronal polarity, and BRSK1 has also been shown to regulate neurotransmitter release presynaptically. BRSK1 is a serine-threonine kinases specifically expressed in the brain, and activated by LKB1-mediated phosphorylation of a threonine residue at their T-loop. (PMID:22020259). It has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3357 Product name: Recombinant human BRSK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 475-778 aa of BC016681 Sequence: TQTLPSRGPRGGGAGEQPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGAAWRSRLNSIRNSFLGSPRFHRRKMQVPTAEEMSSLTPESSPELAKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSSEGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQAQLLSTHDQPSVQALADEKNGAQTRPAGAPPRSLQPPPGRPDPELSSSPRRAPPKDKKLLATNGTPLP Predict reactive species\nFull Name: BR serine\/threonine kinase 1\nCalculated Molecular Weight: 87 kDa\nObserved Molecular Weight: 85-90 kDa\nGenBank Accession Number: BC016681\nGene Symbol: BRSK1\nGene ID (NCBI): 84446\nRRID: AB_2274933\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDC3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869518909609,"sku":"12673-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12673-1-ap","provider":"Iright","version":"1.0","type":"link"}