{"product_id":"proteintech-12676-1-ap","title":"Proteintech, 12676-1-AP, BBS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BBS3 (12676-1-AP) by Proteintech is a Polyclonal antibody targeting BBS3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, canine samples\n12676-1-AP targets BBS3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, HEK-293T cells,  human brain tissue,  mouse brain tissue\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: hTERT-RPE1 cells,  MDCK cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADP-ribosylation factor-like protein 6 (ARL6), belongs to a small GTPase superfamily, is involved in membrane protein trafficking at the base of the ciliary organelle. ARL6 is also named Bardet-Biedl syndrome 3 protein, because defects in ARL6 are a cause of Bardet-Biedl syndrome type 3 (BBS3), which is a genetically heterogeneous disorder characterized by usually severe pigmentary retinopathy, early onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation. ARL6 can interact with many ARL6 interacting proteins and form BBSome complex with other BBS proteins including BBS1, BBS2, BBS4 and so on.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, canine\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3363 Product name: Recombinant human BBS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC024239 Sequence: MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT Predict reactive species\nFull Name: ADP-ribosylation factor-like 6\nCalculated Molecular Weight: 186 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC024239\nGene Symbol: ARL6\/BBS3\nGene ID (NCBI): 84100\nRRID: AB_2058675\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H0F7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868923056297,"sku":"12676-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12676-1-ap","provider":"Iright","version":"1.0","type":"link"}