{"product_id":"proteintech-12678-1-ap","title":"Proteintech, 12678-1-AP, GLIS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLIS3 (12678-1-AP) by Proteintech is a Polyclonal antibody targeting GLIS3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n12678-1-AP targets GLIS3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue,  A549 cells,  BxPC-3 cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. GLIS3 (gLIS family zinc finger 3), also known as ZNF515 that localizes to the nucleus and contains five C2H2-type zinc fingers. Expressed in a variety of tissues, including kidney, brain, liver, lung, ovary, pancreas, thymus and skeletal muscle, GLIS3 functions as both an activator and a suppressor of transcription, specifically binding the consensus sequence 5'-GACCACCCAC-3' through its C2H2-type zinc fingers. Defects in the gene encoding GLIS3 are a cause of NDH syndrome; a neonatal diabetes that is characterized by congenital hypothyroidism, congenital glaucoma, hepatic fibrosis and polycystic kidneys. There are various isoform of GLIS3 and molecular weight of one isoform is 70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3366 Product name: Recombinant human GLIS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 429-775 aa of BC033899 Sequence: LKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSKEQQARKKLRSSTELHPDLLTDCLTVQSLQPATSPRDAAAEGTVGRSPGPGPDLYSAPIFSSNYSSRSGTAAGAVPPPHPVSHPSPGHNVQGSPHNPSSQLPPLTAVDAGAERFAPSAPSPHHISPRRVPAPSSILQRTQPPYTQQPSGSHLKSYQPETNSSFQPNGIHVHGFYGQLQKFCPPHYPDSQRIVPPVSSCSVVPSFEDCLVPTSMGQASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVDRCPSQLSSVYTEG Predict reactive species\nFull Name: GLIS family zinc finger 3\nCalculated Molecular Weight: 775 aa, 84 kDa\nObserved Molecular Weight: 70-85 kDa\nGenBank Accession Number: BC033899\nGene Symbol: GLIS3\nGene ID (NCBI): 169792\nRRID: AB_2877873\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NEA6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869545091241,"sku":"12678-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12678-1-ap","provider":"Iright","version":"1.0","type":"link"}