{"product_id":"proteintech-12699-1-ap","title":"Proteintech, 12699-1-AP, SGK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SGK3 (12699-1-AP) by Proteintech is a Polyclonal antibody targeting SGK3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12699-1-AP targets SGK3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  A375 cells,  human liver tissue,  mouse skin tissue,  rat kidney tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human pancreas cancer tissue,  human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A375 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSerum- and glucocorticoid-inducible kinase 3 (SGK3) is a protein kinase of the AGC family of protein kinase A, protein kinase G, and protein kinase C and functions downstream of phosphatidylinositol 3-kinase (PI3K)(PMID:21084382). It is also named as DKFZp781N0293, CISK, SGK2, SGKL and may be involved in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. SGK3 mediates cell IL-3-dependent survival signals (PMID:12397388). SGK3 has 2 isoforms produced by alternative splicing with the molecular weight of 57 kDa and 53 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3149 Product name: Recombinant human SGK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-496 aa of BC015326 Sequence: TDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL Predict reactive species\nFull Name: serum\/glucocorticoid regulated kinase family, member 3\nCalculated Molecular Weight: 496 aa, 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC015326\nGene Symbol: SGK3\nGene ID (NCBI): 23678\nRRID: AB_2188548\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53EW6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869498200233,"sku":"12699-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12699-1-ap","provider":"Iright","version":"1.0","type":"link"}