{"product_id":"proteintech-12701-1-ap","title":"Proteintech, 12701-1-AP, OMG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OMG (12701-1-AP) by Proteintech is a Polyclonal antibody targeting OMG in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12701-1-AP targets OMG in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spinal cord tissue,  mouse brain tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOMG (oligodendrocyte myelin glycoprotein), also known as OMGP. It is expected to be located in cell membrane, the protein is mainly expressed in the central nervous system in both neurons and oligodendrocytes. The calculated molecular weight of OMG is 50 kDa, and o-glycosylated in its Ser\/Thr-rich repeat domain. It is also a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system. Axonal regeneration in the adult spinal cord is thought to be at least partially blocked after injury by inhibitory myelin components, including Nogo, myelin associated glycoprotein (MAG) and oligodendrocyte-myelin glycoprotein (OMGP).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3210 Product name: Recombinant human OMG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-440 aa of BC018050 Sequence: SLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVANAWKVNASFLLLLNVVVMLAV Predict reactive species\nFull Name: oligodendrocyte myelin glycoprotein\nCalculated Molecular Weight: 440 aa, 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC018050\nGene Symbol: OMG\nGene ID (NCBI): 4974\nRRID: AB_2877877\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23515\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869568946345,"sku":"12701-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12701-1-ap","provider":"Iright","version":"1.0","type":"link"}