{"product_id":"proteintech-12730-1-ap","title":"Proteintech, 12730-1-AP, VASH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VASH1 (12730-1-AP) by Proteintech is a Polyclonal antibody targeting VASH1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n12730-1-AP targets VASH1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, HeLa cells,  MCF-7 cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVASH1, also named as vasohibin 1, is a angiogenesis inhibitor induced by the stimulation with VEGF. High expression of VASH1 has been researched in some tumors as a result of VEGF induction. It has been suggested that VASH-1 is clinically significant in bladder cancer, colorectal cancer and NSCLC.  VASH-1 may be a potential marker of gastric cancer and a target for vascular targeting therapy. 12730-1-AP detects 41 kDa form secreted protein and 36 kDa form protein accumulated within the cells or pericellular milieu in SDS-PAGE.(PMID:19057892, 29042936, 29552154, 26666821)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3435 Product name: Recombinant human VASH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC009031 Sequence: MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG Predict reactive species\nFull Name: vasohibin 1\nCalculated Molecular Weight: 365 aa, 41 kDa\nObserved Molecular Weight: 36 and 41 kDa\nGenBank Accession Number: BC009031\nGene Symbol: VASH1\nGene ID (NCBI): 22846\nRRID: AB_2288318\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7L8A9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869507932329,"sku":"12730-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12730-1-ap","provider":"Iright","version":"1.0","type":"link"}