{"product_id":"proteintech-12737-1-ap","title":"Proteintech, 12737-1-AP, ZFP36 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZFP36 (12737-1-AP) by Proteintech is a Polyclonal antibody targeting ZFP36 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12737-1-AP targets ZFP36 in WB, IHC, IF\/ICC, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, A549 cells,  rat lung tissue\nPositive IHC detected in: human breast cancer tissue,  human bladder tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe expression of many cytokines is regulated post-transcriptionally by factors that modulate mRNA transport, translation, and stability. Much of this regulation occurs by the binding and stabilizing, or destabilizing, of cytokine mRNAs by proteins that recognize adenosine and uridine-rich elements (AREs) in untranslated regions of target transcripts. Zfp36 is a mRNA-binding protein involved in post-transcriptional regulation of AU-rich element (ARE)-containing mRNAs. It was demonstrated to physically interact with the p65 subunit of nuclear factor-κB leading to decreased nuclear import and diminished transcriptional activation mediated by nuclear factor-κB. It acted by specifically binding ARE-containing mRNAs and promoting their degradation, and has a crucial role in the post-transcriptional regulation of tumor necrosis factor (TNF). The calcualted molecular weight of ZFP36 is 34 kDa, but modified ZFP36 is about 40-45 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3461 Product name: Recombinant human ZFP36 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-326 aa of BC009693 Sequence: MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE Predict reactive species\nFull Name: zinc finger protein 36, C3H type, homolog (mouse)\nCalculated Molecular Weight: 326 aa, 34 kDa\nObserved Molecular Weight: 37-44 kDa\nGenBank Accession Number: BC009693\nGene Symbol: ZFP36\nGene ID (NCBI): 7538\nRRID: AB_10598485\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P26651\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868865319081,"sku":"12737-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12737-1-ap","provider":"Iright","version":"1.0","type":"link"}