{"product_id":"proteintech-12745-1-ap","title":"Proteintech, 12745-1-AP, MEK6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEK6 (12745-1-AP) by Proteintech is a Polyclonal antibody targeting MEK6 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n12745-1-AP targets MEK6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human kidney tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAPKK6 (Dual specificity mitogen activated protein kinase kinase 6), also known as MAP2K6 \/ MEK6 \/ MKK6, is a member of MAPKK protein kinase family. MKK6 plays an important role in intracellular signaling pathways leading toward activation of the p38 MAP kinase. MEK6 phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. MEK6 plays a complex role in cancer, with some evidence showing it can promote tumor growth. Overexpression of MEK6 has been linked to decreased survival in lung adenocarcinoma, breast cancer, and melanoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3706 Product name: Recombinant human MAP2K6 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-334 aa of BC012009 Sequence: MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD Predict reactive species\nFull Name: mitogen-activated protein kinase kinase 6\nCalculated Molecular Weight: 334 aa, 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC012009\nGene Symbol: MEK6\nGene ID (NCBI): 5608\nRRID: AB_2141563\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52564\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868970176681,"sku":"12745-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12745-1-ap","provider":"Iright","version":"1.0","type":"link"}