{"product_id":"proteintech-12748-1-ap","title":"Proteintech, 12748-1-AP, Complement factor H Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Complement factor H (12748-1-AP) by Proteintech is a Polyclonal antibody targeting Complement factor H in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human samples\n12748-1-AP targets Complement factor H in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, human blood\nPositive IP detected in: human plasma tissue\nPositive IHC detected in: human liver cancer tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nComplement factor H (CFH) is an abundant plasma glycoprotein that regulates the function of the alternative complement pathway in the fluid phase and on cellular surfaces (PMID: 2963625). Factor H binds to C3b, accelerates the decay of the alternative pathway C3-convertase (C3bBb), and acts as a cofactor for the factor I-mediated proteolytic inactivation of C3b (PMID: 15163532). It plays a critical role in the homeostasis of the complement system in plasma and in the protection of bystander host cells and tissues from damage by complement activation. Abnormalities in factor H have been associated with renal disease (PMID: 18190458).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3482 Product name: Recombinant human CFH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-349 aa of BC037285 Sequence: LPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAV Predict reactive species\nFull Name: complement factor H\nCalculated Molecular Weight: 1231 aa, 139 kDa\nObserved Molecular Weight: 140-150 kDa\nGenBank Accession Number: BC037285\nGene Symbol: Complement factor H\nGene ID (NCBI): 3075\nRRID: AB_10642946\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08603\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869658566825,"sku":"12748-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12748-1-ap","provider":"Iright","version":"1.0","type":"link"}