{"product_id":"proteintech-12804-1-ap","title":"Proteintech, 12804-1-AP, VPS26A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS26A (12804-1-AP) by Proteintech is a Polyclonal antibody targeting VPS26A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12804-1-AP targets VPS26A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, HEK-293 cells,  rat kidney tissue\nPositive IHC detected in: human breast cancer tissue, human cervical cancer tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIn mammals, there are two paralogues of yeast Vps26, VPS26A and VPS26B (PMID: 16190980). VPS26 is a component of the retromer complex composed of VPS26 (VPS26A or VPS26B), VPS29, VPS35, SNX1, and SNX2. VPS26A and VPS26B subunits define distinct retromer complexes (PMID: 21920005). The retromer complex is important in recycling transmembrane receptors from endosomes to the trans-Golgi network (TGN).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3391 Product name: Recombinant human VPS26A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 41-327 aa of BC022505 Sequence: LFYDGESVSGKVNLAFKQPGKRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM Predict reactive species\nFull Name: vacuolar protein sorting 26 homolog A (S. pombe)\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC022505\nGene Symbol: VPS26A\nGene ID (NCBI): 9559\nRRID: AB_2215033\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75436\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868962017449,"sku":"12804-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12804-1-ap","provider":"Iright","version":"1.0","type":"link"}