{"product_id":"proteintech-12810-1-ap","title":"Proteintech, 12810-1-AP, ARNT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARNT2 (12810-1-AP) by Proteintech is a Polyclonal antibody targeting ARNT2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12810-1-AP targets ARNT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  Raji cells\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAryl-hydrocarbon receptor nuclear translocator 2(ARNT2), is a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. It specifically recognizes the xenobiotic response element(XRE). ARNT2 plays an important role in normal glucose handling in pancreatic beta cell function in humans and mice. ARNT2 proteins are dimeric partners for other PAS proteins such as HIF and SIM. ARNT2 and the other ARNT family members, e.g., ARNT, hypoxin inducible factor 1α (HIF1α), HIF2α, and aryl hydrocarbon receptor (AhR), are thought to function as heterodimers, and regulate the expression, and thereby the function, of many genes. Under hypoxic conditions, it complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. Modulation of ARNT2 in pancreatic beta cells affects glucose stimulated INS secretion (GSIS). This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human ARNT2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3536 Product name: Recombinant human ARNT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 363-716 aa of BC036099 Sequence: QDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPGNEWWSPHSRQHFRQPISYARM Predict reactive species\nFull Name: aryl-hydrocarbon receptor nuclear translocator 2\nCalculated Molecular Weight: 716 aa, 79 kDa\nObserved Molecular Weight: 80-85 kDa\nGenBank Accession Number: BC036099\nGene Symbol: ARNT2\nGene ID (NCBI): 9915\nRRID: AB_2059456\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HBZ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869445410985,"sku":"12810-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12810-1-ap","provider":"Iright","version":"1.0","type":"link"}