{"product_id":"proteintech-12813-1-ap","title":"Proteintech, 12813-1-AP, TRPM8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRPM8 (12813-1-AP) by Proteintech is a Polyclonal antibody targeting TRPM8 in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n12813-1-AP targets TRPM8 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver cancer tissue, human prostate cancer tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRPM8, also known as CMR1 (cold-menthol receptor-1), is a nonselective cation channel activated by cold and the cooling substances menthol and icilin (PMID: 11893340; 11882888). It serves as a neuronal sensor of cold temperatures. Functioning TRPM8 channels are required for behavioral responses to innocuous cool, noxious cold, injury-evoked cold hypersensitivity, and cooling-mediated analgesia (PMID: 17538622; 21438154; 16920620; 21984952). Additionally, TRPM8 has also been reported to be involved in thermoregulation and the regulation of basal tear flow (PMID: 21407809; 21076394). TRPM8 is expressed extensively in sensory nerves, human prostate and overexpressed in a variety of cancers including prostate, breast, lung, colon and skin melanomas (PMID: 11325849; 20816009).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3483 Product name: Recombinant human TRPM8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-192 aa of BC001135 Sequence: SFLPVHTIVLIRENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRLSCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEVPVGQEEVC Predict reactive species\nFull Name: transient receptor potential cation channel, subfamily M, member 8\nCalculated Molecular Weight: 1104 aa, 128 kDa\nGenBank Accession Number: BC001135\nGene Symbol: TRPM8\nGene ID (NCBI): 79054\nRRID: AB_2877883\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z2W7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868975222953,"sku":"12813-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12813-1-ap","provider":"Iright","version":"1.0","type":"link"}