{"product_id":"proteintech-12831-1-ap","title":"Proteintech, 12831-1-AP, Alpha E-Catenin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Alpha E-Catenin (12831-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha E-Catenin in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12831-1-AP targets Alpha E-Catenin in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse uterus tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human colon tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAlpha catenin is an essential component of adherens junctions that connects E-cadherin-β-catenin complexes with the actin cytoskeleton. It also recruits a range of other important proteins to developing intercellular junctions. Three alpha catenins exist in human: alpha-E-catenin, alpha-N-catenin, and alpha-T-catenin, which share substantial amino-acid sequence similarity but have distinct tissue distribution. alpha-E-catenin is ubiquitously expressed, alpha-N-catenin is restricted to neuronal tissue, and alpha-T-catenin is primarily expressed in heart tissue. Reduced levels of alpha-E-catenin protein seem to be characteristic of many different human cancers, including malignant tumours of the breast, colon, stomach, oesophagus, bladder and liver. In addition, the loss of alpha-E-catenin often correlates with the degree of tumour differentiation and metastasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3565 Product name: Recombinant human CTNNA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 188-536 aa of BC031262 Sequence: SEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI Predict reactive species\nFull Name: catenin (cadherin-associated protein), alpha 1, 102kDa\nCalculated Molecular Weight: 906 aa, 100 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC031262\nGene Symbol: Alpha E-Catenin\nGene ID (NCBI): 1495\nRRID: AB_2087822\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35221\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868870758569,"sku":"12831-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12831-1-ap","provider":"Iright","version":"1.0","type":"link"}