{"product_id":"proteintech-12837-2-ap","title":"Proteintech, 12837-2-AP, CD247 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD247 (12837-2-AP) by Proteintech is a Polyclonal antibody targeting CD247 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12837-2-AP targets CD247 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  human spleen tissue,  mouse spleen tissue\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD247, also known as CD3Z (T-cell surface glycoprotein CD3 zeta chain), belongs to the CD3Z\/FCER1G family. CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR\/CD3 complex of T-lymphocytes consists of either a TCR alpha\/beta or TCR gamma\/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3889 Product name: Recombinant human CD247 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-164 aa of BC025703 Sequence: FLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR Predict reactive species\nFull Name: CD247 molecule\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC025703\nGene Symbol: CD247\nGene ID (NCBI): 919\nRRID: AB_2244279\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20963\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868932395177,"sku":"12837-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12837-2-ap","provider":"Iright","version":"1.0","type":"link"}