{"product_id":"proteintech-12841-1-ap","title":"Proteintech, 12841-1-AP, CENPH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CENPH (12841-1-AP) by Proteintech is a Polyclonal antibody targeting CENPH in WB, IP, ELISA applications with reactivity to human, mouse samples\n12841-1-AP targets CENPH in WB, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  NIH\/3T3 cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCentromere protein H (CENPH) is a component of the active centromere complex that associates with centromeric DNA and binds spindle microtubules to the chromosomes, which is required for chromosome congression and efficiently align the chromosomes on a metaphase plate. CENPH plays a key role in assembly of kinetochore proteins, mitotic progression and chromosome segregation that may cause misaligned chromosomes and multipolar spindles. Besides, CENPH may be associated with the modulation of the cell cycle through an interaction with CENPC. It has been shown that the expression of CENPH is related to clinical application including colorectal cancer, gastric cancer, renal cell carcinoma, hepatocellular carcinoma and other poor prognosis in various solid tumors. (PMID: 26378239, 27993978,  28819418)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3836 Product name: Recombinant human CENPH protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-247 aa of BC015355 Sequence: MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM Predict reactive species\nFull Name: centromere protein H\nCalculated Molecular Weight: 247 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC015355\nGene Symbol: CENPH\nGene ID (NCBI): 64946\nRRID: AB_2076634\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H3R5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869452521641,"sku":"12841-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12841-1-ap","provider":"Iright","version":"1.0","type":"link"}