{"product_id":"proteintech-12870-1-ap","title":"Proteintech, 12870-1-AP, HLF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HLF (12870-1-AP) by Proteintech is a Polyclonal antibody targeting HLF in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12870-1-AP targets HLF in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, HEK-293 cells,  K-562 cells,  HepG2 cells,  mouse liver tissue,  mouse brain tissue\nPositive IHC detected in: rat liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHepatic leukemia factor (Hlf), is a novel hepatic protein of the proline and acidic amino acid-rich basic leucine zipper (bZip) family, previously studied for its role in circadian rhythm regulated neurotransmitter metabolism in the brain (PMID: 29166614). HLF is an essential regulator of HSC quiescence and that HLF deficiency leads to an exhaustion of HSCs in adult mouse BM during regeneration or following cytotoxic stress (PMID: 29262330).Hlf is able to bind DNA specifically as a homodimer or as a heterodimer with other PAR factors (PMID: 1516826). Western blot analysis detected bands  33 kDa whereas the  66 kDa could be the dimer form of Hlf.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3533 Product name: Recombinant human HLF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC036093 Sequence: MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL Predict reactive species\nFull Name: hepatic leukemia factor\nCalculated Molecular Weight: 295 aa, 33 kDa\nObserved Molecular Weight: 33kDa, 66 kDa\nGenBank Accession Number: BC036093\nGene Symbol: HLF\nGene ID (NCBI): 3131\nRRID: AB_11182935\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16534\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869693595817,"sku":"12870-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12870-1-ap","provider":"Iright","version":"1.0","type":"link"}