{"product_id":"proteintech-12925-1-ap","title":"Proteintech, 12925-1-AP, NCALD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NCALD (12925-1-AP) by Proteintech is a Polyclonal antibody targeting NCALD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12925-1-AP targets NCALD in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, A549 cells,  mouse cerebellum tissue,  human brain tissue,  human heart tissue,  human cerebellum tissue,  rat brain tissue\nPositive IHC detected in: mouse cerebellum tissue, human brain tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNCALD belongs to the recoverin family. And it is a member of the EF-hand calcium-binding protein superfamily. NCALD may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. It plays an important role in the regulation of the neuronal signal transduction process. NCALD is a likely candidate for conferring susceptibility to diabetic nephropathy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3614 Product name: Recombinant human NCALD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC036098 Sequence: MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF Predict reactive species\nFull Name: neurocalcin delta\nCalculated Molecular Weight: 193 aa, 22 kDa\nObserved Molecular Weight: 18-22 kDa\nGenBank Accession Number: BC036098\nGene Symbol: NCALD\nGene ID (NCBI): 83988\nRRID: AB_2149410\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61601\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868926070953,"sku":"12925-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12925-1-ap","provider":"Iright","version":"1.0","type":"link"}