{"product_id":"proteintech-12931-1-ap","title":"Proteintech, 12931-1-AP, YIPF5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YIPF5 (12931-1-AP) by Proteintech is a Polyclonal antibody targeting YIPF5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12931-1-AP targets YIPF5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse liver tissue,  rat brain tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3802 Product name: Recombinant human YIPF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC024737 Sequence: MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPM Predict reactive species\nFull Name: Yip1 domain family, member 5\nCalculated Molecular Weight: 257 aa, 28 kDa\nObserved Molecular Weight: 28-33 kDa\nGenBank Accession Number: BC024737\nGene Symbol: YIPF5\nGene ID (NCBI): 81555\nRRID: AB_2217209\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969M3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869793865897,"sku":"12931-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12931-1-ap","provider":"Iright","version":"1.0","type":"link"}