{"product_id":"proteintech-12945-1-ap","title":"Proteintech, 12945-1-AP, GAGE7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GAGE7 (12945-1-AP) by Proteintech is a Polyclonal antibody targeting GAGE7 in WB, IHC, ELISA applications with reactivity to human samples\n12945-1-AP targets GAGE7 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, BGC-823 cells,  DU 145 cells,  HGC-27 cells,  MKN-45 cells,  PC-3 cells\nPositive IHC detected in: human prostate cancer tissue,  human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGAGE7 (G Antigen 7), also known as CT4.7 or GAGE-7, is a cancer-testis antigen belonging to the GAGE family. It is predominantly expressed in germ cells of the testis and various tumors, including melanoma, lung, and breast cancers, while remaining silent in normal adult tissues (PMID: 10397259). GAGE7 is an intrinsically disordered protein (IDP) of 117 amino acids with a theoretical molecular weight of ~13 kDa; however, it exhibits an apparent molecular weight of ~26 kDa in SDS-PAGE due to its abnormal electrophoretic mobility (PMID: 23029259).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4018 Product name: Recombinant human GAGE7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC031628 Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC Predict reactive species\nFull Name: G antigen 7\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC031628\nGene Symbol: GAGE7\nGene ID (NCBI): 2579\nRRID: AB_2877895\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O76087\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869543256233,"sku":"12945-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12945-1-ap","provider":"Iright","version":"1.0","type":"link"}