{"product_id":"proteintech-12982-1-ap","title":"Proteintech, 12982-1-AP, TPTE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPTE (12982-1-AP) by Proteintech is a Polyclonal antibody targeting TPTE in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n12982-1-AP targets TPTE in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  human testis tissue,  BxPC-3 cells,  mouse testis tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTPTE(Transmembrane phosphatase with tensin homology) is also named as CT44, BJ-HCC-5 and belongs to the non receptor class of the protein-tyrosine phosphatase family. The gene encodes a predicted polypeptide of 551 amino acids with at least 2 potential transmembrane domains and a tyrosine phosphatase motif. TPTE may be involved in the signal transduction pathways of the endocrine or spermatogenic function of the testis(PMID:10598804). It is putatively involved in linking the cell membrane to cytoskeleton. This protein is very similar in sequence to PTEN through the phosphatase and C2 domains, but lacks a PDZ binding motif and an extensively phosphorylated C-terminal tail(PMID:17240336). It has 4 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3606 Product name: Recombinant human TPTE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-533 aa of BC028719 Sequence: KRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVVRIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICSTAKESLYYFGERRTDKTHSEKFQGVETPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEKMTSSDVVAGSD Predict reactive species\nFull Name: transmembrane phosphatase with tensin homology\nCalculated Molecular Weight: 62 kDa, 64 kDa\nObserved Molecular Weight: 62 kDa, 64 kDa\nGenBank Accession Number: BC028719\nGene Symbol: TPTE\nGene ID (NCBI): 7179\nRRID: AB_2206336\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56180\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887836582057,"sku":"12982-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12982-1-ap","provider":"Iright","version":"1.0","type":"link"}