{"product_id":"proteintech-12999-1-ap","title":"Proteintech, 12999-1-AP, Ephrin B1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Ephrin B1 (12999-1-AP) by Proteintech is a Polyclonal antibody targeting Ephrin B1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12999-1-AP targets Ephrin B1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, rat kidney tissue\nPositive IHC detected in: human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEFNB1 (Ephrin B1) is a member of the ephrin family, which are membrane-bound guidance cues that interact with Eph receptors, a family of receptor tyrosine kinases. EFNB1 is X-inactivated, and it has been proposed that in heterozygous females, patchy loss of ephrin B1 disturbs tissue boundary formation at the developing coronal suture (PMID: 34824583, 18627045). EFNB1 mainly plays a central part in cell adhesion, angiogenesis, and development of the nervous system (PMID: 30326247).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3669 Product name: Recombinant human EFNB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-239 aa of BC016649 Sequence: LEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVA Predict reactive species\nFull Name: ephrin-B1\nCalculated Molecular Weight: 346 aa, 38 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC016649\nGene Symbol: Ephrin B1\nGene ID (NCBI): 1947\nRRID: AB_10644156\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P98172\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869459337385,"sku":"12999-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12999-1-ap","provider":"Iright","version":"1.0","type":"link"}