{"product_id":"proteintech-13008-1-ap","title":"Proteintech, 13008-1-AP, PTPRS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPRS (13008-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRS in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13008-1-AP targets PTPRS in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nType II a receptor protein tyrosine phosphatases (rPTPσ) are cell surface receptors important for nervous system development, function, and repair.The expression of rPTPσ has previously been reported in b-cells and other target organs for INS although the probes chosen did not permit to distinguish between the splice variants.Proteolytic processing near the transmembrane domain generates an extracellular N-terminal E-domain of 130 kDa and a C-terminal P-domain of approximately 85 kDa of rPTPσ,and the short splice variants rPTPσ 3 and 4 contain an E-domain of 95 kDa (PMID: 16552719). rPTPσ expression was observed in tissue lysates of the adult mouse sensory-motor cortex and thoracic spinal cord (T8-T10) as a 75-80kDa immunoreactive band (PMID: 19780196).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3691 Product name: Recombinant human rPTPσ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-128 aa of BC029496 Sequence: GGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLRGP Predict reactive species\nFull Name: protein tyrosine phosphatase, receptor type, S\nCalculated Molecular Weight: 128aa,14 kDa; 1948aa,217 kDa\nObserved Molecular Weight: 75-100 kDa\nGenBank Accession Number: BC029496\nGene Symbol: PTPRS\nGene ID (NCBI): 5802\nRRID: AB_10858319\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13332\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868944421033,"sku":"13008-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13008-1-ap","provider":"Iright","version":"1.0","type":"link"}