{"product_id":"proteintech-13011-1-ap","title":"Proteintech, 13011-1-AP, ETV5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ETV5 (13011-1-AP) by Proteintech is a Polyclonal antibody targeting ETV5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13011-1-AP targets ETV5 in WB, IHC, IF\/ICC, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MCF-7 cells,  PC-3 cells,  Raji cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nETS variant gene 5(ETV5) belongs to the ETS oncogene family that shares a conserved peptide, ETS domain, which mediates sequence-specific DNA binding. ETV5 is a transcription factor and is required for spermatogonial stem cell self-renewal. ETV5 can be negatively regulated by COP1, a tumor suppressor. Also it has a role in branching morphogenesis in the developing kidney\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3708 Product name: Recombinant human ETV5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-510 aa of BC007333 Sequence: SGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMDRCSSLPYAEGFAY Predict reactive species\nFull Name: ets variant 5\nCalculated Molecular Weight: 510 aa, 58 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC007333\nGene Symbol: ETV5\nGene ID (NCBI): 2119\nRRID: AB_2278092\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P41161\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868860272809,"sku":"13011-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13011-1-ap","provider":"Iright","version":"1.0","type":"link"}