{"product_id":"proteintech-13040-1-ap","title":"Proteintech, 13040-1-AP, GRID1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRID1 (13040-1-AP) by Proteintech is a Polyclonal antibody targeting GRID1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13040-1-AP targets GRID1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human gliomas tissue, human brain tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRID1 (Glutamate Ionotropic Receptor Delta Type Subunit 1) is a protein-coding gene that belongs to the family of ionotropic glutamate receptors. These receptors are crucial for rapid excitatory synaptic transmission and synaptic plasticity in the central nervous system. GRID1 is primarily expressed in various brain regions, including the cortex, hippocampus, amygdala, striatum, thalamus, nucleus accumbens, lateral hooked nucleus, and dorsal raphe nucleus. In the hippocampus, GRID1 is specifically expressed in the granule cells of the dentate gyrus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3694 Product name: Recombinant human GRID1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-348 aa of BC039263 Sequence: IHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEANNPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFINEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCTRNNHRISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMAS Predict reactive species\nFull Name: glutamate receptor, ionotropic, delta 1\nCalculated Molecular Weight: 1009 aa, 112 kDa\nObserved Molecular Weight: 100-112 kDa\nGenBank Accession Number: BC039263\nGene Symbol: GRID1\nGene ID (NCBI): 2894\nRRID: AB_10638439\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULK0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869689958569,"sku":"13040-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13040-1-ap","provider":"Iright","version":"1.0","type":"link"}