{"product_id":"proteintech-13060-2-ap","title":"Proteintech, 13060-2-AP, CDK2AP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK2AP1 (13060-2-AP) by Proteintech is a Polyclonal antibody targeting CDK2AP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n13060-2-AP targets CDK2AP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  HeLa cells\nPositive IHC detected in: human placenta tissue, human brain tissue,  human heart tissue,  human liver tissue,  human ovary tissue,  human skin tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3736 Product name: Recombinant human CDK2AP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC034717 Sequence: MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS Predict reactive species\nFull Name: cyclin-dependent kinase 2 associated protein 1\nCalculated Molecular Weight: 115 aa, 13 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC034717\nGene Symbol: CDK2AP1\nGene ID (NCBI): 8099\nRRID: AB_10340136\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14519\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869654601897,"sku":"13060-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13060-2-ap","provider":"Iright","version":"1.0","type":"link"}