{"product_id":"proteintech-13062-1-ap","title":"Proteintech, 13062-1-AP, SNX22 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNX22 (13062-1-AP) by Proteintech is a Polyclonal antibody targeting SNX22 in IP, ELISA applications with reactivity to human,  mouse samples\n13062-1-AP targets SNX22 in IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSorting nexins (SNXs) are a large group of proteins that contain Phox (PX) domain and involve in regulating endocytosis and endosome sorting.  SNX22 (sorting nexin 22) is a 193 amino acid protein that contains one phox domain and belongs to the SNX family.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3751 Product name: Recombinant human SNX22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC019655 Sequence: MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHFPTDPKASNWG Predict reactive species\nFull Name: sorting nexin 22\nCalculated Molecular Weight: 193 aa, 22 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC019655\nGene Symbol: SNX22\nGene ID (NCBI): 79856\nRRID: AB_2877909\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96L94\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887811547305,"sku":"13062-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13062-1-ap","provider":"Iright","version":"1.0","type":"link"}