{"product_id":"proteintech-13074-2-ap","title":"Proteintech, 13074-2-AP, CCK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCK (13074-2-AP) by Proteintech is a Polyclonal antibody targeting CCK in IHC, ELISA applications with reactivity to human, mouse samples\n13074-2-AP targets CCK in IHC, IF, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human pancreas tissue, human stomach tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCholecystokinin (CCK) is a classic gut hormone. CCK is also a complex system of peptides expressed in several molecular forms in enteroendocrine I cells, in cerebral and peripheral neurons, in cardiac myocytes and spermatozoa. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3725 Product name: Recombinant human CCK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC008283 Sequence: MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS Predict reactive species\nFull Name: cholecystokinin\nCalculated Molecular Weight: 115 aa, 13 kDa\nGenBank Accession Number: BC008283\nGene Symbol: CCK\nGene ID (NCBI): 885\nRRID: AB_2228728\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06307\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869398093993,"sku":"13074-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13074-2-ap","provider":"Iright","version":"1.0","type":"link"}