{"product_id":"proteintech-13082-1-ap","title":"Proteintech, 13082-1-AP, IL-17A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-17A (13082-1-AP) by Proteintech is a Polyclonal antibody targeting IL-17A in IHC, ELISA applications with reactivity to human samples\n13082-1-AP targets IL-17A in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon cancer tissue, human cervical cancer tissue,  human stomach cancer tissue,  human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2\/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased. This antibody got 32-35 kDa band in western blot, maybe due to homodimer formation and differential glycosylations.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3733 Product name: Recombinant human IL-17A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC067505 Sequence: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA Predict reactive species\nFull Name: interleukin 17A\nCalculated Molecular Weight: 155 aa, 18 kDa\nGenBank Accession Number: BC067505\nGene Symbol: IL-17A\nGene ID (NCBI): 3605\nENSEMBL Gene ID: ENSG00000112115\nRRID: AB_10644322\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16552\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868836614313,"sku":"13082-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13082-1-ap","provider":"Iright","version":"1.0","type":"link"}