{"product_id":"proteintech-13098-1-ap","title":"Proteintech, 13098-1-AP, Fas\/CD95 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Fas\/CD95 (13098-1-AP) by Proteintech is a Polyclonal antibody targeting Fas\/CD95 in WB, IP, ELISA applications with reactivity to human samples\n13098-1-AP targets Fas\/CD95 in WB, IHC, IF, IP, CoIP, CHIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, HT-29 cells,  Jurkat cells,  HeLa cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFas (CD95\/APO-1) is a transmembrane glycoprotein belonging to the tumor necrosis factor (TNF) receptor superfamily. It can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The molecular mass of native Fas is 38 kDa, the high molecular weight form (40-55 kDa) of Fas is due to glycosylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, monkey, hamster, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3718 Product name: Recombinant human FAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 156-335 aa of BC012479 Sequence: ECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV Predict reactive species\nFull Name: Fas (TNF receptor superfamily, member 6)\nCalculated Molecular Weight: 35-38 kDa\nObserved Molecular Weight: 38-45 kDa\nGenBank Accession Number: BC012479\nGene Symbol: Fas\/CD95\nGene ID (NCBI): 355\nRRID: AB_2278042\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25445\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868826292393,"sku":"13098-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13098-1-ap","provider":"Iright","version":"1.0","type":"link"}