{"product_id":"proteintech-13159-1-ap","title":"Proteintech, 13159-1-AP, DHX36 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DHX36 (13159-1-AP) by Proteintech is a Polyclonal antibody targeting DHX36 in WB, IHC, IP, ELISA applications with reactivity to human samples\n13159-1-AP targets DHX36 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human brain tissue,  PC-3 cells,  HEK-293T cells,  A431 cells\nPositive IP detected in: PC-3 cells, A431 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDHX36, also known as RNA associated with AU-rich element (RHAU) and G4R1, is an adenosine triphosphate (ATP)-dependent RNA helicase that belongs to the DExH\/D family of RNA modifying enzymes. Proteins in this family involve in a wide range of cellular functions including RNA splicing, ribosome assembly, messenger RNA (mRNA) stability, microRNA processing, ribonucleoprotein remodeling and RNA trafficking. DHX36 is an RNA helicase that has specificity for DNA and RNA G4-quadruplexes, and resolves G4 structures into separate nucleotide strands for metabolic processing of G-rich sequence.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3799 Product name: Recombinant human DHX36 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-385 aa of BC036035 Sequence: MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGREIGMWYAKKQGQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGTLDQKLLEDLQKKKNDLRYIEMQHFREKLPSYGMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIVCTQPRRISAISVAERVAAERAESCGSGNSTGYQIRLQSRLPRKQGSILYCTTGIILQWLQSDPYLSSVSHIVLDEIHERNLQSDVLMTVVKDLLNFRSDLKVILMSATLNAEKFSEYFGNCPMIH Predict reactive species\nFull Name: DEAH (Asp-Glu-Ala-His) box polypeptide 36\nCalculated Molecular Weight: 1008 aa, 115 kDa\nObserved Molecular Weight: 110-120 kDa\nGenBank Accession Number: BC036035\nGene Symbol: DHX36\nGene ID (NCBI): 170506\nRRID: AB_2092157\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H2U1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868905623721,"sku":"13159-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13159-1-ap","provider":"Iright","version":"1.0","type":"link"}