{"product_id":"proteintech-13163-1-ap","title":"Proteintech, 13163-1-AP, PSMA\/GCPII Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMA\/GCPII (13163-1-AP) by Proteintech is a Polyclonal antibody targeting PSMA\/GCPII in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13163-1-AP targets PSMA\/GCPII in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, human liver tissue,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human prostate cancer tissue, human colon cancer tissue,  human gliomas tissue,  mouse kidney tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMA(Prostate-specific membrane antigen) is also named as FOLH1, FOLH, NAALAD1, PSM and belongs to the peptidase M28 family. PSMA is a 100-120 kDa integral transmembrane glycoprotein, considered to be a highly specific marker of the prostate gland, and has successfully been used as a marker of circulating prostatic epithelial cells(PMID:10074909; 15680901). It is involved in conversion of the major neurotransmitter (NAAG) to NAA and free glutamate. It has 8 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3812 Product name: Recombinant human FOLH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 45-385 aa of BC025672 Sequence: SSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGG Predict reactive species\nFull Name: folate hydrolase (prostate-specific membrane antigen) 1\nCalculated Molecular Weight: 719 aa, 81 kDa\nObserved Molecular Weight: 100 kDa, 120 kDa\nGenBank Accession Number: BC025672\nGene Symbol: PSMA\nGene ID (NCBI): 2346\nRRID: AB_2106442\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q04609\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868920402089,"sku":"13163-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13163-1-ap","provider":"Iright","version":"1.0","type":"link"}