{"product_id":"proteintech-13168-1-ap","title":"Proteintech, 13168-1-AP, DCBLD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DCBLD2 (13168-1-AP) by Proteintech is a Polyclonal antibody targeting DCBLD2 in WB, IHC, IP, ELISA applications with reactivity to human samples\n13168-1-AP targets DCBLD2 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MKN-45 cells, human liver tissue,  human brain tissue,  SW 1990 cells,  U2OS cells\nPositive IP detected in: U2OS cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDCBLD2, also known as ESDN or CLCP1, was first identified from human coronary arterial cells by a signal sequence trap method. DCBLD2 regulates proliferation, migration, and invasion in various tumors, including glioma, hypopharyngeal squamous cell carcinoma, and myxofibrosarcoma. The human DCBLD2 protein has a predicted molecular mass of ∼80 kDa based on its amino acid sequence, although it regularly displays an effective molecular mass of ∼130 kDa via SDS-PAGE (PMID: 30902898).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3821 Product name: Recombinant human DCBLD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 519-743 aa of BC029658 Sequence: YDLPYWDRAGFYLMVSLACRHNEGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL Predict reactive species\nFull Name: discoidin, CUB and LCCL domain containing 2\nCalculated Molecular Weight: 775 aa, 89 kDa\nObserved Molecular Weight: 93 kDa, 127 kDa\nGenBank Accession Number: BC029658\nGene Symbol: DCBLD2\nGene ID (NCBI): 131566\nRRID: AB_2292662\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96PD2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869455896745,"sku":"13168-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13168-1-ap","provider":"Iright","version":"1.0","type":"link"}