{"product_id":"proteintech-13170-1-ap","title":"Proteintech, 13170-1-AP, CIDEA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CIDEA (13170-1-AP) by Proteintech is a Polyclonal antibody targeting CIDEA in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13170-1-AP targets CIDEA in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue\nPositive IHC detected in: mouse brown adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCell death-inducing DNA fragmentation factor (DFFA)-like effector (CIDE) family proteins, including Cidea, Cideb, and Fsp27 (Cidec), are lipid droplet (LD)-associated proteins playing important roles in LD fusion, lipid secretion, and very-low-density-lipoprotein (VLDL) maturation. Cidea is highly enriched in adult brown adipose tissue (BAT), and its deficiency results in the accumulation of smaller LDs in brown adipocytes, improved INS sensitivity, and resistance to diet-induced obesity. The MW of this protein is 25 kDa, and this antibody specially recognises the 25 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3824 Product name: Recombinant human CIDEA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-253 aa of BC031896 Sequence: MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG Predict reactive species\nFull Name: cell death-inducing DFFA-like effector a\nCalculated Molecular Weight: 253 aa, 28 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC031896\nGene Symbol: CIDEA\nGene ID (NCBI): 1149\nRRID: AB_10642957\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60543\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868869021865,"sku":"13170-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13170-1-ap","provider":"Iright","version":"1.0","type":"link"}