{"product_id":"proteintech-13193-1-ap","title":"Proteintech, 13193-1-AP, PPM1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPM1B (13193-1-AP) by Proteintech is a Polyclonal antibody targeting PPM1B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n13193-1-AP targets PPM1B in WB, IHC, IF\/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells\nPositive IHC detected in: human breast cancer tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPM1B is a member of the metal-dependent serine\/threonine protein phosphatase (PPM) family with important regulatory functions in cellular signalling pathways(PMID: 18066953). PPM1B is also an important negative regulator of several stress signalling pathways and has been shown to negatively regulate the stress-activated p38 and JNK pathways by directly dephosphorylating upstream signalling proteins(PMID: 9824284). Moreover, PPM1B has also been shown to prevent cell death by negatively regulating necrotic cell death in a RIP3 dephosphorylation-dependent manner.(PMID: 25751141) PPM1B can be detected as the WM of 36-55 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3871 Product name: Recombinant human PPM1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC012002 Sequence: MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI Predict reactive species\nFull Name: protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform\nCalculated Molecular Weight: 479 aa, 53 kDa\nObserved Molecular Weight: 36, 53 kDa\nGenBank Accession Number: BC012002\nGene Symbol: PPM1B\nGene ID (NCBI): 5495\nRRID: AB_10644118\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75688\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868986953897,"sku":"13193-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13193-1-ap","provider":"Iright","version":"1.0","type":"link"}