{"product_id":"proteintech-13198-2-ap","title":"Proteintech, 13198-2-AP, Carbonic anhydrase 1\/CA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Carbonic anhydrase 1\/CA1 (13198-2-AP) by Proteintech is a Polyclonal antibody targeting Carbonic anhydrase 1\/CA1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13198-2-AP targets Carbonic anhydrase 1\/CA1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, Jurkat cells,  rat spleen tissue\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCA1(Carbonic anhydrase 1) is also named as CAB and belongs to the alpha-carbonic anhydrase family, which may reside in cytoplasm, in mitochondria, or in secretory granules, or associate with membranes in cell. It forms a large family of genes encoding zinc metalloenzymes of great physiologic importance. Extracellular CA1 mediates hemorrhagic retinal and cerebral vascular permeability through prekallikrein activation(PMID:17259996).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3932 Product name: Recombinant human CA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC027890 Sequence: MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF Predict reactive species\nFull Name: carbonic anhydrase I\nCalculated Molecular Weight: 261 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC027890\nGene Symbol: CA1\nGene ID (NCBI): 759\nRRID: AB_2275041\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00915\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868932165801,"sku":"13198-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13198-2-ap","provider":"Iright","version":"1.0","type":"link"}