{"product_id":"proteintech-13224-1-ap","title":"Proteintech, 13224-1-AP, LRG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRG1 (13224-1-AP) by Proteintech is a Polyclonal antibody targeting LRG1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n13224-1-AP targets LRG1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma\nPositive IHC detected in: mouse liver tissue, human liver tissue,  human liver cancer tissue,  human pancreas cancer tissue,  mouse brain tissue,  mouse pancreas tissue,  mouse prostate tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLRG1, also known as LRG, is a member of the leucine-rich repeat (LRR) family of proteins, containing eight LRR (leucine-rich) repeats and one LRRCT domain. The gene of LRG1 maps to chromosome 19p13.3, and encodes a 347-amino acid protein with a predicted unmodified molecular weight of 38 kD. The mature form of LRG1 is a secreted glycoprotein which has 312 amino acids and an experimentally determined molecular mass of 45 kD. The LRR family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation. Levels of the LRG protein are markedly elevated in acute appendicitis and therefore could be used as a diagnostic aid.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3964 Product name: Recombinant human LRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-347 aa of BC034389 Sequence: DCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ Predict reactive species\nFull Name: leucine-rich alpha-2-glycoprotein 1\nCalculated Molecular Weight: 347 aa, 38 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC034389\nGene Symbol: LRG1\nGene ID (NCBI): 116844\nRRID: AB_2138714\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02750\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868852670633,"sku":"13224-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13224-1-ap","provider":"Iright","version":"1.0","type":"link"}