{"product_id":"proteintech-13280-1-ap","title":"Proteintech, 13280-1-AP, CEND1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEND1 (13280-1-AP) by Proteintech is a Polyclonal antibody targeting CEND1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13280-1-AP targets CEND1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, SH-SY5Y cells,  human brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Neuro-2a cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCell cycle exit and neuronal differentiation 1 (CEND1) also known as BM88, is a neuronal protein associated in vivo with terminal neuron-generating divisions, marking the exit of proliferative cells from the cell cycle (PMID: 17971443). CEND1 expression is critical for  the NEUROG2-driven reprogramming of astrocytes, suggesting the existence of a reciprocal feedback loop leading to neurogenesis (PMID: 26321141). CEND1 is an integral membrane protein composed of two 23-kDa polypeptide chains linked together by disulfide bridges.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4024 Product name: Recombinant human CEND1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC034732 Sequence: MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQPPAAPTTAPAKKTSAKADPALLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFN Predict reactive species\nFull Name: cell cycle exit and neuronal differentiation 1\nCalculated Molecular Weight: 149 aa, 15 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC034732\nGene Symbol: CEND1\nGene ID (NCBI): 51286\nRRID: AB_2291632\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N111\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869524021417,"sku":"13280-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13280-1-ap","provider":"Iright","version":"1.0","type":"link"}