{"product_id":"proteintech-13294-1-ap","title":"Proteintech, 13294-1-AP, SNX25 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNX25 (13294-1-AP) by Proteintech is a Polyclonal antibody targeting SNX25 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13294-1-AP targets SNX25 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: EL-4 cells, Raji cells,  Jurkat cells,  mouse thymus tissue,  C6 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: Raji cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSNXs (sorting nexin), a family of proteins playing roles in cargo sorting and signaling from compartments within the endocytic network, regulate traffic of membrane proteins including TGF-β receptors. Sorting Nexin 25 (SNX25) has been recently proposed to modulate TGF-β signaling through endosomal sorting of TGF-β receptors for lysosomal degradation.This antibody can recognize two isoforms: 98-105 kDa and 65 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3995 Product name: Recombinant human SNX25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-556 aa of BC029868 Sequence: QINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQEETEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPELRVHLDQLKAGQV Predict reactive species\nFull Name: sorting nexin 25\nCalculated Molecular Weight: 98 kDa\nObserved Molecular Weight: 98-105 kDa, 65 kDa\nGenBank Accession Number: BC029868\nGene Symbol: SNX25\nGene ID (NCBI): 83891\nRRID: AB_2192549\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H3E2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989542569,"sku":"13294-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13294-1-ap","provider":"Iright","version":"1.0","type":"link"}