{"product_id":"proteintech-13309-1-ap","title":"Proteintech, 13309-1-AP, GHRL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GHRL (13309-1-AP) by Proteintech is a Polyclonal antibody targeting GHRL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13309-1-AP targets GHRL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human stomach tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGHRL encodes ghrelin-obestatin preproprotein, which generates ghrelin and obestatin. Ghrelin is predominantly produced in endocrine cells in the gastric mucosa, called X\/A-like or ghrelin cells, from where it is secreted into the plasma. In the pituitary gland, ghrelin stimulates GH release and regulates food intake and energy metabolism. Obestatin was initially reported to be an endogenous ligand for the orphan G protein-coupled receptor GPR39 and was involved in satiety and decreased food intake; however, these findings are controversial. Recent reports show that obestatin is involved in inhibiting thirst and anxiety, improving memory, regulating sleep, affecting cell proliferation, and increasing the secretion of pancreatic juice enzymes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4141 Product name: Recombinant human GHRL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-117 aa of BC025791 Sequence: LSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK Predict reactive species\nFull Name: ghrelin\/obestatin prepropeptide\nCalculated Molecular Weight: 117 aa, 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC025791\nGene Symbol: GHRL\nGene ID (NCBI): 51738\nRRID: AB_2294726\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBU3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868966867113,"sku":"13309-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13309-1-ap","provider":"Iright","version":"1.0","type":"link"}