{"product_id":"proteintech-13310-1-ap","title":"Proteintech, 13310-1-AP, ATP2C1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP2C1 (13310-1-AP) by Proteintech is a Polyclonal antibody targeting ATP2C1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13310-1-AP targets ATP2C1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A431 cells,  human brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP2C1, also known as hSPCA1, belongs to the family of P-type cation transport ATPases. ATP2C1 is a Golgi-localized ATPase that mediates Golgi uptake of cytosolic Ca(2+) and Mg(2+) and has a role in regulating Ca(2+) and Mn(2+) cellular content (PMID: 11741891). ATP2C1 is found in most tissues except colon, thymus, spleen, and leukocytes. It is expressed in keratinocytes (PMID: 15831496, 14632183). Defects in ATP2C1 cause Hailey-Hailey disease (HHD)(PMID: 10615129, 28035777).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4143 Product name: Recombinant human ATP2C1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 320-654 aa of BC028139 Sequence: LGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKA Predict reactive species\nFull Name: ATPase, Ca++ transporting, type 2C, member 1\nCalculated Molecular Weight: 919 aa, 101 kDa\nObserved Molecular Weight: 95-103 kDa\nGenBank Accession Number: BC028139\nGene Symbol: ATP2C1\nGene ID (NCBI): 27032\nRRID: AB_10640808\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P98194\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868963000489,"sku":"13310-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13310-1-ap","provider":"Iright","version":"1.0","type":"link"}