{"product_id":"proteintech-13313-1-ap","title":"Proteintech, 13313-1-AP, CXCL7\/PPBP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCL7\/PPBP (13313-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL7\/PPBP in WB, IHC, ELISA applications with reactivity to human, mouse samples\n13313-1-AP targets CXCL7\/PPBP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  human liver tissue,  human plasma tissue\nPositive IHC detected in: mouse placenta tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPBP, also named as CXCL7, NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4147 Product name: Recombinant human PPBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-128 aa of BC028217 Sequence: TALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Predict reactive species\nFull Name: pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)\nCalculated Molecular Weight: 128 aa, 14 kDa\nObserved Molecular Weight: 8-14 kDa\nGenBank Accession Number: BC028217\nGene Symbol: PPBP\nGene ID (NCBI): 5473\nRRID: AB_10597238\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02775\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869529002153,"sku":"13313-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13313-1-ap","provider":"Iright","version":"1.0","type":"link"}