{"product_id":"proteintech-13314-1-ap","title":"Proteintech, 13314-1-AP, GMEB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GMEB2 (13314-1-AP) by Proteintech is a Polyclonal antibody targeting GMEB2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13314-1-AP targets GMEB2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue,  mouse ovary tissue,  mouse thymus tissue\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGMEB2, also named as Glucocorticoid modulatory element-binding protein 2, is a 530 amino acid protein, which is expressed in peripheral blood lymphocytes and fetal liver. GMEB2 as a trans-acting factor that binds to glucocorticoid modulatory elements (GME) present in the TAT (tyrosine aminotransferase) promoter and increases sensitivity to low concentrations of glucocorticoids. The calcualted molecular weight of GMEB2 is 56 kDa, but modified GMEB2 is about 65-70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4157 Product name: Recombinant human GMEB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-304 aa of BC036305 Sequence: MATPDVSVHMEEVVVVTTPDTAVDGSGVEGVKTVLVTTNLAPHGGDLTEDNMETENAAAAAAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQYDEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKIDLSGARVSLSSPTSAEYIPLTPAAADVNGSPATITIETCEDPGDWTAAIGDDTFTFWRGLKDAGLLDEVIQEFHQELVETMRGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLASHKCQ Predict reactive species\nFull Name: glucocorticoid modulatory element binding protein 2\nCalculated Molecular Weight: 530 aa, 56 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC036305\nGene Symbol: GMEB2\nGene ID (NCBI): 26205\nRRID: AB_2110829\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKD1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887653212329,"sku":"13314-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13314-1-ap","provider":"Iright","version":"1.0","type":"link"}