{"product_id":"proteintech-13317-1-ap","title":"Proteintech, 13317-1-AP, Cytoglobin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytoglobin (13317-1-AP) by Proteintech is a Polyclonal antibody targeting Cytoglobin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13317-1-AP targets Cytoglobin in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue,  human heart tissue,  human uterus tissue,  mouse brain tissue,  mouse kidney tissue,  mouse lung tissue,  mouse small intestine tissue,  mouse spleen tissue,  mouse stomach tissue,  PC-3 cells,  rat kidney tissue,  Transfected HEK-293 cells\nPositive IHC detected in: human liver cancer tissue,  human heart tissue,  human liver tissue,  human prostate cancer tissue,  human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytoglobin, also named as Histoglobin, HGb, STAP and CYGB, belongs to the globin family. Cytoglobin may have a protective function during conditions of oxidative stress. It may be involved in intracellular oxygen storage or transfer. It serves as a defensive mechanism against oxidative stress both in vitro and in vivo.(PMID:21224051) Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues. The protein, with calculated MW of 21 kd, runs as a 29kd one in canine retina, kidney, liver, lung, and heart. It may be caused by posttranslational modification of the protein. Various immuno-staining patterns were reported including nuclear, cytoplasm and extracellular location.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4161 Product name: Recombinant human CYGB protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-190 aa of BC029798 Sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP Predict reactive species\nFull Name: cytoglobin\nCalculated Molecular Weight: 190 aa, 21 kDa\nObserved Molecular Weight: 21-29 kDa\nGenBank Accession Number: BC029798\nGene Symbol: Cytoglobin\nGene ID (NCBI): 114757\nRRID: AB_2090645\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WWM9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868940062889,"sku":"13317-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13317-1-ap","provider":"Iright","version":"1.0","type":"link"}